Protein Info for BWI76_RS24925 in Klebsiella michiganensis M5al

Annotation: DnaA initiator-associating protein DiaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13580: SIS_2
  • amino acids 13 to 144 (132 residues), 103.1 bits, E=1.3e-33

Best Hits

Swiss-Prot: 100% identical to DIAA_KLEP7: DnaA initiator-associating protein DiaA (diaA) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K12961, DnaA initiator-associating protein (inferred from 99% identity to esc:Entcl_0549)

MetaCyc: 41% identical to D-sedoheptulose 7-phosphate isomerase (Aneurinibacillus thermoaerophilus)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

• ADP-L-glycero-β-D-manno-heptose biosynthesis (5/5 steps found)
• GDP-D-glycero-α-D-manno-heptose biosynthesis (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Galactose metabolism
• Inositol phosphate metabolism
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-, 5.3.1.28

Use Curated BLAST to search for 5.3.1.- or 5.3.1.28

Sequence Analysis Tools

See A0A285BAA0 at UniProt or InterPro

Protein Sequence (196 amino acids)

>BWI76_RS24925 DnaA initiator-associating protein DiaA (Klebsiella michiganensis M5al)
MLDRIKACFTESIQTQIAAAEALPDAISRAAMTLVQSLLNGNKILCCGNGTSAANAQHFA
ASMINRFETERPGLPAIALNTDNVVLTAIANDRLHDEIYAKQVRALGHAGDVLLAISTRG
NSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGQQDVEIRIPSHRSARIQEMHMLTVN
CLCDLIDNTLFPHQDD