Protein Info for BWI76_RS24620 in Klebsiella michiganensis M5al

Annotation: PadR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF03551: PadR" amino acids 45 to 110 (66 residues), 52.5 bits, see alignment E=2e-18

Best Hits

Swiss-Prot: 60% identical to YQJI_ECOLI: Transcriptional regulator YqjI (yqjI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 84% identity to kpe:KPK_0612)

Predicted SEED Role

"Transcriptional regulator, PadR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAC8 at UniProt or InterPro

Protein Sequence (184 amino acids)

>BWI76_RS24620 PadR family transcriptional regulator (Klebsiella michiganensis M5al)
MRHHHEEGRGPRGRHDEHGEHGEHGRRGGGRRQRFFGHGELRLVILDILTRNASHGYELI
KEIETMTQGNYSPSPGVIYPTLDLLQDQGLISVADENGRKKIAITADGSQLHTENQQQLE
QIQAKLHARMVGCELRKNPQMKRALENFKAVLDLKVNQQAITEAQLKQIVGVIDRAAMEI
SQLD