Protein Info for BWI76_RS24605 in Klebsiella michiganensis M5al

Annotation: dihydroxyacetone kinase subunit DhaM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 TIGR02364: dihydroxyacetone kinase, phosphotransfer subunit" amino acids 2 to 127 (126 residues), 133.5 bits, see alignment E=4.9e-43 PF03610: EIIA-man" amino acids 4 to 120 (117 residues), 89.1 bits, see alignment E=4.5e-29 TIGR01003: phosphocarrier, HPr family" amino acids 158 to 235 (78 residues), 53.1 bits, see alignment E=2.4e-18 PF00381: PTS-HPr" amino acids 160 to 237 (78 residues), 65.7 bits, see alignment E=6.3e-22 PF05524: PEP-utilisers_N" amino acids 260 to 370 (111 residues), 73.8 bits, see alignment E=2.8e-24 PF00391: PEP-utilizers" amino acids 395 to 464 (70 residues), 50.7 bits, see alignment E=2.4e-17

Best Hits

Swiss-Prot: 89% identical to DHAM_KLEOK: PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM (dhaM) from Klebsiella oxytoca (strain ATCC 8724 / DSM 4798 / JCM 20051 / NBRC 3318 / NRRL B-199 / KCTC 1686)

KEGG orthology group: None (inferred from 75% identity to eae:EAE_03860)

MetaCyc: 65% identical to dihydroxyacetone kinase subunit M (Escherichia coli K-12 substr. MG1655)
Phosphoenolpyruvate--glycerone phosphotransferase. [EC: 2.7.1.121]

Predicted SEED Role

"Phosphoenolpyruvate-dihydroxyacetone phosphotransferase (EC 2.7.1.121), subunit DhaM; DHA-specific IIA component / DHA-specific phosphocarrier protein HPr / DHA-specific EI component" in subsystem Dihydroxyacetone kinases (EC 2.7.1.121)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.121

Use Curated BLAST to search for 2.7.1.121

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9V7 at UniProt or InterPro

Protein Sequence (473 amino acids)

>BWI76_RS24605 dihydroxyacetone kinase subunit DhaM (Klebsiella michiganensis M5al)
MVNLVIVSHSARLGEGVGELARQMLMNDGCKLAIAAGIDDPASPIGTDPIKVMEAIESVA
DADHVLVMMDIGSALLSAETALDLLDPAIAAKVRLCAAPLVEGTLAATVSAAAGADIDKV
IEDAMNALEAKRVQLGLPSQPQPPSLTAELADDRDARSVSVVIQNPNGLHVRPASKLVAA
LAGFNADLVLEKEGKCVTPDSLNQIALLQVRRNDTLRLLARGPDADAALAAFQALAAENF
GEQTEATPALQPTHAARIQGQVVLYPRPQNSVTREKSAAIGQQQLRLKRAIDRTLDDLSA
LTALAEEKYSADIAAIFSGHHTLLDDPDLYTAACDIVRDEQCSAEWAWHQVLSDLSQQYR
HLDDAYLQARYIDIEDILHRTLRHLNESSEALPQFSTPSILVADDIFPSTVVQLDGRQVK
GICLQESSEHAHGAIIARQAGIAMLCQQRDVLTTLQNGETVTLDIPGKRVIRG