Protein Info for BWI76_RS24580 in Klebsiella michiganensis M5al

Annotation: PTS-dependent dihydroxyacetone kinase operon transcriptional regulator DhaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 PF00989: PAS" amino acids 200 to 302 (103 residues), 57.2 bits, see alignment E=4e-19 PF00158: Sigma54_activat" amino acids 326 to 486 (161 residues), 124.9 bits, see alignment E=7.1e-40 PF14532: Sigma54_activ_2" amino acids 339 to 491 (153 residues), 65.8 bits, see alignment E=1.2e-21 PF02954: HTH_8" amino acids 586 to 624 (39 residues), 44.5 bits, see alignment 2.5e-15

Best Hits

Swiss-Prot: 90% identical to DHAR_CITFR: Glycerol metabolism operon regulatory protein (dhaR) from Citrobacter freundii

KEGG orthology group: K05880, transcriptional activator for dhaKLM operon (inferred from 93% identity to kpu:KP1_4789)

Predicted SEED Role

"Phosphoenolpyruvate-dihydroxyacetone phosphotransferase operon regulatory protein DhaR" in subsystem Dihydroxyacetone kinases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BA34 at UniProt or InterPro

Protein Sequence (637 amino acids)

>BWI76_RS24580 PTS-dependent dihydroxyacetone kinase operon transcriptional regulator DhaR (Klebsiella michiganensis M5al)
MTAQTQSFPLVITQSWHRCSKFMQRETWQTPHQAQGLTFESICRRKTALLTIGQAALEDA
WEFMDNRPCALFILDESACILSRCGDPQTLDQLAALGFRDGSYCAESIIGSCALSLASML
GQPVKTTGEQHFKHALHGWSFSSTPVFDNHGRLFGSISLCCLIEEQASPDLSLTLAIARE
VGNSLLTDSLLSESNRHLNQMYGLLESMDDGVMAWNEQGVLQFLNVQAARLLHLDAQASQ
GKNINELVTLPALLRRAIKHARGLNHVEVTFESQHQFVDAVITLKPIVEEQGNSFILLLH
PVEQMRQLMTSQLGKVSHTFEQMSADDPETRRLIHFGRQAARGAFPVLLCGEEGVGKELL
SQAIHNESERGGGPYIAVNCQLYADSVLGQDFMGSAPTDDENGRLSRLELANGGTLFLEK
IEYLAPELQSALLQVIKQGVLTRLDARRLIPVDVKVIATTTVDLANLVEQNRFSRQLYYA
LHSFEIVIPPLRARRNSIPSLVHNRLKSLEKRFSSRLKMDDDALAQLVAYSWPGNDFELN
SVIENIAISSDNGHIRLSNLPEYLFAERPGADAGSSLLPASLTFSAIEKEAIIHAARVTS
GRVQEMAQLLNIGRTTLWRKMKHYDIDAGQFKRGRME