Protein Info for BWI76_RS24505 in Klebsiella michiganensis M5al

Annotation: urease subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 TIGR00192: urease, beta subunit" amino acids 1 to 102 (102 residues), 150.1 bits, see alignment E=9.3e-49 PF00699: Urease_beta" amino acids 3 to 99 (97 residues), 152.2 bits, see alignment E=1.7e-49

Best Hits

Swiss-Prot: 89% identical to URE2_KLEP3: Urease subunit beta (ureB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K01429, urease subunit beta [EC: 3.5.1.5] (inferred from 89% identity to kpe:KPK_0653)

MetaCyc: 65% identical to urease beta subunit (Sinorhizobium meliloti Rm2011)
Urease. [EC: 3.5.1.5]

Predicted SEED Role

"Urease beta subunit (EC 3.5.1.5)" in subsystem Urea decomposition (EC 3.5.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.5

Use Curated BLAST to search for 3.5.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAB2 at UniProt or InterPro

Protein Sequence (106 amino acids)

>BWI76_RS24505 urease subunit beta (Klebsiella michiganensis M5al)
MIPGEYQIKPGQIALNAGRATCSIIVENHGDRPIQVGSHYHFAEVNPALKFDRQQATGYR
LNIAAGTAVRFEPGQKREVELVALAGTRAVYGFRGEVMGALEANDE