Protein Info for BWI76_RS24485 in Klebsiella michiganensis M5al

Annotation: bifunctional dihydroneopterin aldolase/7,8-dihydroneopterin epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00526: FolB domain
  • amino acids 1 to 115 (115 residues), 140.7 bits, E=2.7e-45
• PF02152: FolB
  • amino acids 4 to 113 (110 residues), 118.1 bits, E=1.4e-38
• TIGR00525: dihydroneopterin aldolase
  • amino acids 4 to 114 (111 residues), 97.6 bits, E=6.8e-32

Best Hits

Swiss-Prot: 88% identical to FOLB_SHIFL: Dihydroneopterin aldolase (folB) from Shigella flexneri

KEGG orthology group: None (inferred from 94% identity to eae:EAE_03660)

MetaCyc: 88% identical to dihydroneopterin aldolase (Escherichia coli K-12 substr. MG1655)
RXN-10856 [EC: 5.1.99.8]; Dihydroneopterin aldolase. [EC: 5.1.99.8, 4.1.2.25]

Predicted SEED Role

"Dihydroneopterin aldolase (EC 4.1.2.25)" in subsystem Folate Biosynthesis (EC 4.1.2.25)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (4/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (2/7 steps found)
• tetrahydromethanopterin biosynthesis (3/14 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.25 or 5.1.99.8

Sequence Analysis Tools

See A0A285B9M0 at UniProt or InterPro

Protein Sequence (127 amino acids)

>BWI76_RS24485 bifunctional dihydroneopterin aldolase/7,8-dihydroneopterin epimerase (Klebsiella michiganensis M5al)
MDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWDNRKAAASDDVSDCLSYADISELV
INHVEGARFALVERVAEEIADLLLEKFQSPWVRIKVSKPGAVARAANVGVIIERGLNLKQ
NFSGHTR