Protein Info for BWI76_RS24440 in Klebsiella michiganensis M5al

Annotation: 3,4-dihydroxy-2-butanone-4-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 TIGR00506: 3,4-dihydroxy-2-butanone-4-phosphate synthase" amino acids 13 to 209 (197 residues), 278.6 bits, see alignment E=1.3e-87 PF00926: DHBP_synthase" amino acids 17 to 208 (192 residues), 280.6 bits, see alignment E=2.7e-88

Best Hits

Swiss-Prot: 98% identical to RIBB_KLEP3: 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_03615)

MetaCyc: 93% identical to 3,4-dihydroxy-2-butanone-4-phosphate synthase (Escherichia coli K-12 substr. MG1655)
3,4-dihydroxy-2-butanone-4-phosphate synthase. [EC: 4.1.99.12]

Predicted SEED Role

"3,4-dihydroxy-2-butanone 4-phosphate synthase (EC 4.1.99.12)" (EC 4.1.99.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9S6 at UniProt or InterPro

Protein Sequence (217 amino acids)

>BWI76_RS24440 3,4-dihydroxy-2-butanone-4-phosphate synthase (Klebsiella michiganensis M5al)
MNQTLLSSFGTAFERVEHALDALREGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIR
HGSGIVCLCLTEDRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRA
AIADGAKPSDLNRPGHVFPLRAQPGGVLTRGGHTEATIDLVTLAGFKPAGVLCELTNDDG
SMARAPQCIEFAQQHNMAVVTIEDLAAYRREHERKAS