Protein Info for BWI76_RS24290 in Klebsiella michiganensis M5al

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 155 to 180 (26 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details PF09335: VTT_dom" amino acids 48 to 173 (126 residues), 69.4 bits, see alignment E=2.1e-23

Best Hits

Swiss-Prot: 89% identical to YGHB_ECO57: Inner membrane protein YghB (yghB) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 95% identity to kpn:KPN_03429)

Predicted SEED Role

"DedA family inner membrane protein YghB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9P0 at UniProt or InterPro

Protein Sequence (219 amino acids)

>BWI76_RS24290 membrane protein (Klebsiella michiganensis M5al)
MVVIQEIVAALWQHDFAALANPHVVGVVYLVMFATLFLENGLLPASFLPGDSLLLLAGAL
IAKGVMDFVPTVAILTAAASLGCWLSYIQGRWLGNTVTVKRWLGHLPHKYHQRATCMFDK
HGLLALLAGRFLAFVRTLLPTMAGISGLPNRRFQFFNWLSALLWVGVVTGLGYALSMIPF
VKRHEDQVMTCLMILPIALLIAGLLGTVIVVIKKKYCNA