Protein Info for BWI76_RS24255 in Klebsiella michiganensis M5al

Annotation: thiol:disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 60 to 127 (68 residues), 25.3 bits, E=3.1e-09
• PF13409: GST_N_2
  • amino acids 66 to 127 (62 residues), 27.7 bits, E=6.7e-10
• PF13410: GST_C_2
  • amino acids 174 to 243 (70 residues), 36.5 bits, E=8.7e-13
• PF00043: GST_C
  • amino acids 182 to 250 (69 residues), 21.4 bits, E=4.9e-08

Best Hits

Swiss-Prot: 84% identical to YGHU_ECOLI: Disulfide-bond oxidoreductase YghU (yghU) from Escherichia coli (strain K12)

KEGG orthology group: K11209, GST-like protein (inferred from 93% identity to kpe:KPK_0699)

MetaCyc: 84% identical to disulfide reductase / organic hydroperoxide reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6256

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

See A0A285BA45 at UniProt or InterPro

Protein Sequence (288 amino acids)

>BWI76_RS24255 thiol:disulfide oxidoreductase (Klebsiella michiganensis M5al)
MSENNYQPPKVWEWKQNNGGAFANINRPVSGATHDRVLPVGAHPLQLYSLGTPNGQKVTI
MLEELLALGVSGAEYDAWLIRIGEGDQFSSGFVEVNPNSKIPALRDHSTTPPTRVFESGS
ILLYLAEKFGFFLPKDPAGRTETLNWLFWLQGSAPFLGGGFGHFFSYAPVKIEYAIDRFT
MEAKRQLDVLDKQLARGRFVAGEEYTIADMAIWPWYGNVVLGNVYNAAEFLDAGSYKNVL
RWAQDVGNRPAVQRGRMVNRTSGPLNEQLHERHAASDFETQTEDKRQA