Protein Info for BWI76_RS24195 in Klebsiella michiganensis M5al

Annotation: anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 45 to 84 (40 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 133 to 166 (34 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 261 to 278 (18 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 318 to 336 (19 residues), see Phobius details amino acids 349 to 372 (24 residues), see Phobius details amino acids 379 to 397 (19 residues), see Phobius details amino acids 402 to 429 (28 residues), see Phobius details amino acids 441 to 461 (21 residues), see Phobius details PF00939: Na_sulph_symp" amino acids 23 to 461 (439 residues), 187 bits, see alignment E=6.9e-59 TIGR00785: transporter, divalent anion:Na+ symporter (DASS) family" amino acids 45 to 461 (417 residues), 394.2 bits, see alignment E=3.4e-122 PF03600: CitMHS" amino acids 57 to 402 (346 residues), 186.5 bits, see alignment E=7.7e-59

Best Hits

Swiss-Prot: 55% identical to Y608_HAEIN: Uncharacterized transporter HI_0608 (HI_0608) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K14445, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2/3/5 (inferred from 79% identity to vcm:VCM66_A0024)

MetaCyc: 79% identical to dicarboxylate:Na+ symporter (Vibrio cholerae O1 biovar El Tor str. N16961)
TRANS-RXN-500

Predicted SEED Role

"Di-and tricarboxylate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BA35 at UniProt or InterPro

Protein Sequence (462 amino acids)

>BWI76_RS24195 anion transporter (Klebsiella michiganensis M5al)
MNKNDMSPLPTNTHEWFFNRNSIIILLDIVLFIVLYNTLPYEPKVVMGLSMLAFIAVLWL
TEALHVTVTAIMVPVMAVLLGVFNTQAALNSFANSTIFLFLGGFALAAAMHVQGLDKVIA
DKVLAMARGKMSLAVFMLFGVTALLSMWISNTATAAMMMPLVLGILSKVDSKNSHSTYVF
VLLGIAYSASIGGMATIVGSPPNAIAAAEVGLSFFDWMKFGFPAMIVLLPVAIAILYLVF
RPELKGTFETNSERVDWDKGKIVTLAIFALTVFFWIFSGPINDLLGGFKSFDTIVALGAI
ILVNFARVVHWKDIEKTADWGVLLLFGGGICLSNVLKETGTSLFLANQISGMVAHMGIFI
IILVIATFVVFLTEFASNTASAALLIPVFASVAEAFGMSPVILSVLIAIAASCAFMLPVA
TPPNAIVFATGHIKQQEMMRAGLFLNIACIIVLTGFSMLFWV