Protein Info for BWI76_RS23970 in Klebsiella michiganensis M5al

Annotation: mechanosensitive ion channel protein MscS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 24 to 47 (24 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 96 to 126 (31 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 16 to 64 (49 residues), 54.3 bits, see alignment 2e-18 PF21088: MS_channel_1st" amino acids 72 to 112 (41 residues), 33.4 bits, see alignment 6.9e-12 PF00924: MS_channel_2nd" amino acids 114 to 180 (67 residues), 75.2 bits, see alignment E=7e-25 PF21082: MS_channel_3rd" amino acids 187 to 268 (82 residues), 69.8 bits, see alignment E=4.4e-23

Best Hits

Swiss-Prot: 87% identical to MSCS_ECOLI: Small-conductance mechanosensitive channel (mscS) from Escherichia coli (strain K12)

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 90% identity to kpe:KPK_0746)

MetaCyc: 87% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Protein involved in stability of MscS mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9H7 at UniProt or InterPro

Protein Sequence (285 amino acids)

>BWI76_RS23970 mechanosensitive ion channel protein MscS (Klebsiella michiganensis M5al)
MEDLNVVDSINNAGSWLVRNQALLLSYAVNIVAALAIIIVGLIVARIVSNTVNRLMRARH
IDATVADFLSALVRYAVIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA
GVLLVVFRPFRAGEYVDLGGIAGTVLNVQIFSTTLRSADGKIVVVPNGKIIAGNIINFSR
EPVRRNEFIIGVAYDADIDKVKQLLTNIIESDERILKDREMTVRLNELGASSVNYVVRVW
SKSSDLQSVYWDVLERIKRDFDANGIGFPYPQMDVHVIRPQEKAE