Protein Info for BWI76_RS23715 in Klebsiella michiganensis M5al

Updated annotation (from data): 2-deoxy-D-ribonate transporter 1
Rationale: Specifically important in carbon source 2-Deoxy-D-ribonic acid lithium salt. Similar to deoxyribonate transporters in other bacteria. However it is not clear why this organism has two deoxyribonate transporters (this gene and BWI76_RS23725)
Original annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 140 (25 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details PF07690: MFS_1" amino acids 29 to 392 (364 residues), 139.7 bits, see alignment E=5.7e-45

Best Hits

KEGG orthology group: None (inferred from 97% identity to kpu:KP1_2744)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B927 at UniProt or InterPro

Protein Sequence (445 amino acids)

>BWI76_RS23715 2-deoxy-D-ribonate transporter 1 (Klebsiella michiganensis M5al)
MSAINEKAVNGTQLQRTHKKIYRHLMPLLIVAYIISFIDRTNIGMAKATMSVDIGLSATA
FGLGAGLFFLTYAVLEIPSNLFLTRIGARRWIARIMITWGIISCGMAFVTGPTSFYVMRL
LLGAAEAGLYPGIIYYLTLWFGREERAKATGLFLLGVCLANIIGAPLGGLLLSLDGMSGW
HGWQWMFFIEGLPAIALAFVVWRRLPDKPADARWLDSHDVQAITAVLEKEAEETRHTPSR
FSLKTALTTRVFLLLVLIYFTHQFSVYGLSYFLPGIIGSWGQLTPLQIGLLTAIPWIAAA
AGGILLPRFARTEQRSRSMLMAGYLVMATGMAIGAIAGHGVALLGFSLAAFMFFAMQSII
FNWLPSIMSGHMLAGSFGLLNCLGLCGGFLGPFILGAFEDRTGAATSGLWFAVALLIVGA
LASLLIKSSSSSTPASAKQARGENA