Protein Info for BWI76_RS23695 in Klebsiella michiganensis M5al

Updated annotation (from data): deoxyribonyl-CoA synthetase
Rationale: Specifically important in carbon source 2-Deoxy-D-ribonic acid lithium salt. K. michiganensis appears to metabolize deoxyribonate via acyl-CoA intermediates.
Original annotation: putative acyl-CoA synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 transmembrane" amino acids 70 to 83 (14 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details PF00501: AMP-binding" amino acids 16 to 370 (355 residues), 227.4 bits, see alignment E=2.7e-71 PF13193: AMP-binding_C" amino acids 420 to 495 (76 residues), 59 bits, see alignment E=7.1e-20

Best Hits

KEGG orthology group: None (inferred from 96% identity to kpu:KP1_2748)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B993 at UniProt or InterPro

Protein Sequence (518 amino acids)

>BWI76_RS23695 deoxyribonyl-CoA synthetase (Klebsiella michiganensis M5al)
MSSTSADFQNLYQALSRSAARSPDALALAFEDRRYLYRDFHLRVQRAMAQLDRIWSLRKG
DRILLAWGNHPAFCEVLFAALGLGIEVVPFSTKLKQAESEELVGHIAPRAVLFDATVQDW
LKQTPDALCVSLSEWQALSLPDPLTRLPTPVNRDDTAVMMFTSGTTGEPKGAIITHHNLL
CAIDAYAQKLNLTAADSTILAVPIYHITGLSALLALFISLGASLWLQHRFNAPQVINTLR
EQNITFLHGSPTIFILLCQAAREQSASHPGDFPALRTIACGAGHLSDGLIAELKTLFPHT
AIQPIYGLTETTSPATIFPGDVWGSDKCGSSGQAIPGLAIAIRNDRQQPLPAGQIGHIWL
KGDVVIREYWQHSERRPSCDAQGWFCTGDLGYLDDEGWLYIKDRSKDMINRGGEKIYSLE
LENILSTYRGVREVAVIPTPSPVYGEEPVAFIVPDGQHHLTSEEILGWLKVKIARFKLPA
RIIFTRVLPRTHNGKVSKQQLKARLAESIITLSTEDKK