Protein Info for BWI76_RS23615 in Klebsiella michiganensis M5al

Annotation: multidrug transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 647 transmembrane" amino acids 25 to 54 (30 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details amino acids 361 to 379 (19 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 413 to 432 (20 residues), see Phobius details amino acids 437 to 457 (21 residues), see Phobius details amino acids 469 to 487 (19 residues), see Phobius details PF13515: FUSC_2" amino acids 350 to 481 (132 residues), 36.9 bits, see alignment E=3.6e-13

Best Hits

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (647 amino acids)

>BWI76_RS23615 multidrug transporter (Klebsiella michiganensis M5al)
MQSLWPFLTRELRDAPGRANYTLRLTLSCAVLIVLFMTLHIPFLAVALIVVFYVSQPNVL
MIKLVSVVFVLTVSVALGGVLLIIKWTYDYPLIRLVASVILFFCAIYLMRVLGKLGLAFF
VVALAVIYAQTFPSMTSQSEILVRLLLWLWVAINTAILVTLLVNACFQQAFPGYQFKARL
VVMLRQTAKVLSQPDEGEPQPTFTEIAGQFNQLQSLYQQAARATPEIAASPQAWQSLMAA
ALRCYHLTALLQPGDDHPDARRRIARELNALADNLPATAAADIQTLVVPRDSDNSAILQE
IAEVLARLARGEAVPLPRGEVEKAPLLLPDAWSNPAYLHFALKTLLATLLCYVFYTAADW
QGIHTIMLSCVIVAQPGLGATMQKTWLRIGGALLATLIALLLIVFVQPWTDSLSGLLAMT
LPVFALAAWIAAGSERIAYAGIQIGFTFALAFLSWFGPLSNLTELRDRVIGILLGVLVSS
IVHLYLWPDSEAPRLKARLAQLYRQLAQTLAARDDEVQLVPLFAALTESETLINRVSTEP
LGTYAHPWPEAKNWPTRASFRQAEEILRLSEGYRLYAAPGDTFLARCAPRLEDYAAGLDA
QQIAAERSQALLPDPANPFGAPLVNALAALPTWPFASSVIPRQATRS