Protein Info for BWI76_RS23610 in Klebsiella michiganensis M5al

Annotation: multidrug transporter subunit MdtN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 51 to 95 (45 residues), 45.6 bits, see alignment 6.9e-16 PF16576: HlyD_D23" amino acids 51 to 286 (236 residues), 47.1 bits, see alignment E=2.8e-16 PF13437: HlyD_3" amino acids 211 to 294 (84 residues), 49.9 bits, see alignment E=7.4e-17

Best Hits

Swiss-Prot: 62% identical to MDTN_SHIFL: Multidrug resistance protein MdtN (mdtN) from Shigella flexneri

KEGG orthology group: None (inferred from 93% identity to kva:Kvar_0767)

MetaCyc: 62% identical to putative multidrug efflux pump membrane fusion protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-351

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9M6 at UniProt or InterPro

Protein Sequence (342 amino acids)

>BWI76_RS23610 multidrug transporter subunit MdtN (Klebsiella michiganensis M5al)
MTQSRSSVIRKKWPLLALVLAAIVALIVVIWQLQTSPETNDAYVYADTIDVVPEVSGRIV
EMPIRDNQRVKKGDLLFRIDPRPYQAMLDDAKARLTTLDAQIMLTQRTIKAQEYNAQSVS
AAVERAKALVKQTTSSRIRLEPLVPQGFASQEDLDQARTAEKAARAELEATLLQAKQASA
AVTGVDAMVAQRAGILAQIALAELHLEFTEVRAPFNGVVVALKTTIGQYASALKPVFTLL
DDDHWYVVANFRETDLQNVRPGVPARITVMTNHGRTFEGVVDSVGTGVLPDGGSVIEGLP
VIQKSINWVHVSQRFPVKIAVKDPDPALFRMGASASAVLQPQ