Protein Info for BWI76_RS23585 in Klebsiella michiganensis M5al

Annotation: minor component of type 1 fimbriae

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF09160: FimH_man-bind" amino acids 50 to 188 (139 residues), 142.5 bits, see alignment E=8.6e-46 PF00419: Fimbrial" amino acids 220 to 320 (101 residues), 31.4 bits, see alignment E=2.2e-11

Best Hits

KEGG orthology group: K07350, minor fimbrial subunit (inferred from 55% identity to cko:CKO_03714)

Predicted SEED Role

"mannose-specific adhesin FimH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9D8 at UniProt or InterPro

Protein Sequence (320 amino acids)

>BWI76_RS23585 minor component of type 1 fimbriae (Klebsiella michiganensis M5al)
MNQRITAPLRCRMALVKALWLALVLAGFSTSVRAYTCYDSTGTILNSDSGGKVSNVYVNL
QPSLGAGQNLVVDLSSSIYCKNDAPDRRNDMVSMLQGSAYSGLLTNFTGSLKYYGVSYSF
PLNSPTASHNFTSGNYTSWNTQLYLTPISTASGLAISAGSHIATLVMYQVGSDINGGGNV
RTSKFTWNIYANNSVIIPTGGCDVSARNVTVTLPEYPGSTAVPLTVRCGQNQKIGFYLSG
TTADSANTVFTNTSSASPAQGIGVQLLRNGTILRSNSTVSMGTVGTSAVNLGLTATYART
SGQVTAGNVQSIIGVTFVYQ