Protein Info for BWI76_RS23380 in Klebsiella michiganensis M5al

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 99 to 275 (177 residues), 54.4 bits, see alignment E=6.9e-19

Best Hits

Swiss-Prot: 47% identical to YESP_BACSU: Probable ABC transporter permease protein YesP (yesP) from Bacillus subtilis (strain 168)

KEGG orthology group: K10193, oligogalacturonide transport system permease protein (inferred from 97% identity to cro:ROD_28861)

Predicted SEED Role

"Putative ABC sugar transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B824 at UniProt or InterPro

Protein Sequence (296 amino acids)

>BWI76_RS23380 sugar ABC transporter permease (Klebsiella michiganensis M5al)
MNENKMLGLAWISPYIIGLIVFTAFPFVSSFFLSFTEYDLMSPPVFNGIENYRYMLTEDG
LFWKSMGVTFAYVFLTIPLKLAFALGIAFVLNFKLRGIGFFRTAYYIPSILGSSVAIAVL
WRALFAIDGLLNSFIGVLGFDPVNWLGEPSLALMSVTLLRVWQFGSAMVIFLAALQNVPQ
SQYEAAMIDGASKWQMFMKVTVPLITPVIFFNFIMQTTQAFQEFTGPYVITGGGPTYSTY
LFSLYIYDTAFKYFDMGYGAALAWVLFLVVAVFAAIAFKSSKYWVFYSADKGGKNG