Protein Info for BWI76_RS23375 in Klebsiella michiganensis M5al
Annotation: cupin
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 43% identical to KDGF_DICD3: Pectin degradation protein KdgF (kdgF) from Dickeya dadantii (strain 3937)
KEGG orthology group: None (inferred from 94% identity to cro:ROD_28851)MetaCyc: 44% identical to unsaturated pyranuronate lyase monomer (Yersinia enterocolitica)
RXN-12877 [EC: 4.2.99.25]; 4.2.99.25 [EC: 4.2.99.25]
Predicted SEED Role
"Pectin degradation protein KdgF" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization
MetaCyc Pathways
- 4-deoxy-L-threo-hex-4-enopyranuronate degradation (5/5 steps found)
- alginate degradation (2/7 steps found)
- superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.2.99.25
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B7R5 at UniProt or InterPro
Protein Sequence (108 amino acids)
>BWI76_RS23375 cupin (Klebsiella michiganensis M5al) MFIFHKETTLEDLGNGVTRRILAHDGKMMAVEVNFEAGAIGPMHNHPHEQLTYVLSGEFE FTIGDEKHVVSAGDTLYKKPNIMHGCVCLKSGTLLDTFTPVRQDFLQQ