Protein Info for BWI76_RS23195 in Klebsiella michiganensis M5al

Annotation: ethanolamine utilization protein EutP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF10662: PduV-EutP" amino acids 1 to 141 (141 residues), 198.4 bits, see alignment E=2.3e-63 TIGR02528: ethanolamine utilization protein, EutP" amino acids 2 to 142 (141 residues), 205.9 bits, see alignment E=1.5e-65

Best Hits

Swiss-Prot: 97% identical to PDUV_SALTY: Propanediol utilization protein PduV (pduV) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04029, ethanolamine utilization protein EutP (inferred from 96% identity to sec:SC2065)

Predicted SEED Role

"Propanediol utilization protein PduV" in subsystem Propanediol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B816 at UniProt or InterPro

Protein Sequence (150 amino acids)

>BWI76_RS23195 ethanolamine utilization protein EutP (Klebsiella michiganensis M5al)
MKRLMFIGPSQCGKTSLTQGLRGEALHYKKTQAIEWSPMAIDTPGEYLENRCLYSALLTS
ACEADVIALVLNADAQWSPFSPGFTAPMNRPTIGLVTKADLADPQRISLIAEWLTQAGAG
QIFVTSALNNSGLDAVLDFLNSKEPLCLTK