Protein Info for BWI76_RS23055 in Klebsiella michiganensis M5al

Annotation: cobalamin biosynthesis protein CbiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 61 to 79 (19 residues), see Phobius details PF11760: CbiG_N" amino acids 55 to 134 (80 residues), 120.7 bits, see alignment E=3.2e-39 PF11761: CbiG_mid" amino acids 140 to 216 (77 residues), 47.7 bits, see alignment E=2.3e-16 PF01890: CbiG_C" amino acids 231 to 347 (117 residues), 93.8 bits, see alignment E=1.7e-30

Best Hits

Swiss-Prot: 88% identical to CBIG_SALTY: Cobalt-precorrin-5A hydrolase (cbiG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02189, cobalamin biosynthesis protein CbiG (inferred from 91% identity to cko:CKO_00810)

MetaCyc: 88% identical to cobalt-precorrin 5A hydrolase (Salmonella enterica enterica serovar Typhimurium)
RXN-8763 [EC: 3.7.1.12]

Predicted SEED Role

"Cobalamin biosynthesis protein CbiG" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7T9 at UniProt or InterPro

Protein Sequence (351 amino acids)

>BWI76_RS23055 cobalamin biosynthesis protein CbiG (Klebsiella michiganensis M5al)
MNTVKPESIALFCLTPGGVRLAKRLAAMLPLTCFTSEKLLEEGFLPFENGFASAAREAFS
SYSALIFIGATGIAVRVLAPLVNDKFSDPAVVVIDERGQHVISLLSGHAGGANALSRYLA
GMLGADPVITTATDVNEMAALDTLAFQLNARMVDFRAAVKTVNQMLVSHQRVGLWWDDEL
DEDVSRCDRRGFITVTDLHQLPELDALVCVTLRNELPAIAVPHWKLVPQRVVAGIGCRRD
TPFPLLATLLARQLEAQRLDPLALKAIGSVTLKKHEQGLIQLASCCRVPFETFTADALRE
HEHHFPASSFVRNTVGVGSVSGPAAWLLSHGQLLGETLREQGVTITLGVSH