Protein Info for BWI76_RS23045 in Klebsiella michiganensis M5al

Annotation: cobalt-precorrin-6A/precorrin-6x reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR00715: precorrin-6x reductase" amino acids 3 to 233 (231 residues), 177.3 bits, see alignment E=2.3e-56 PF02571: CbiJ" amino acids 4 to 240 (237 residues), 242.8 bits, see alignment E=1.9e-76

Best Hits

Swiss-Prot: 85% identical to CBIJ_SALTY: Cobalt-precorrin-6A reductase (cbiJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05895, precorrin-6X reductase [EC: 1.3.1.54] (inferred from 86% identity to sea:SeAg_B2148)

MetaCyc: 85% identical to cobalt-precorrin-6A reductase (Salmonella enterica enterica serovar Typhimurium)
RXN-8765 [EC: 1.3.1.106]

Predicted SEED Role

"Cobalt-precorrin-6x reductase (EC 1.3.1.54)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 1.3.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.106 or 1.3.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7Y9 at UniProt or InterPro

Protein Sequence (259 amino acids)

>BWI76_RS23045 cobalt-precorrin-6A/precorrin-6x reductase (Klebsiella michiganensis M5al)
MSEVLVIGGTSDARALCQQLDAAQVRYTLSVATPTGQQLAGDIRGRVRCGRLEPEEMIAW
LKANRTRWVIDASHPYAEAVSRNIVRACETAGVLLSRYQRPEQLSGLTHPLLYTVESIEQ
ACEVARRFGPRVLLTTGSKDLARWRAGLGEKTLLARVLPVADVIAQCAALGFGVGEIFAL
CGPFSAEFNAAFYRQCRADVVITKASGAEGGYQEKVQPCLDAGIPCIVITRPAPLVTGEE
LLESQAAFARRLARWLAAA