Protein Info for BWI76_RS23025 in Klebsiella michiganensis M5al
Annotation: cobalt ABC transporter substrate-binding protein CbiN
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to CBIN_CITK8: Cobalt transport protein CbiN (cbiN) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
KEGG orthology group: K02009, cobalt transport protein (inferred from 98% identity to cko:CKO_00816)Predicted SEED Role
"Additional substrate-specific component CbiN of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B7J7 at UniProt or InterPro
Protein Sequence (93 amino acids)
>BWI76_RS23025 cobalt ABC transporter substrate-binding protein CbiN (Klebsiella michiganensis M5al) MKKTLILLAMVVALVILPFFVDHGGEFGGSDGEAESQIQVVAPHYEPWFQPLYEPASGEI ESLLFTLQGSLGAAVIFYILGYSKGRQRRDDRV