Protein Info for BWI76_RS23015 in Klebsiella michiganensis M5al
Annotation: cobalt transporter ATP-binding subunit
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 86% identical to CBIO_SALPA: Cobalt import ATP-binding protein CbiO (cbiO) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)
KEGG orthology group: K02006, cobalt/nickel transport system ATP-binding protein (inferred from 91% identity to cko:CKO_00818)Predicted SEED Role
"ATPase component CbiO of energizing module of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B7Q6 at UniProt or InterPro
Protein Sequence (271 amino acids)
>BWI76_RS23015 cobalt transporter ATP-binding subunit (Klebsiella michiganensis M5al) MLATTDLWFRYQDEPVLKGLTLDFSHHAVTGLVGANGCGKSTLFMNLSGLLRPQSGAVQW QGKPLDYSKRGLLALRQQVATVFQDPDQQIFYTDIDSDIAFSLRNLGVAEEEIARRVDDA LTLVDAQGFRHQPIQCLSHGQKKRVAIAGALVLQARYLLLDEPTAGLDPSGRAQMIDIIK RIADRGNHVAISSHDIDLIYEVSDAVYVLRRGEVLAHGEPGEVFARSELMAQAGLTQPWL VKLHAQLGLPLCKTEEEFFTRMRSNAMKEAS