Protein Info for BWI76_RS23010 in Klebsiella michiganensis M5al

Annotation: cobyric acid synthase CobQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 TIGR00313: cobyric acid synthase CobQ" amino acids 5 to 494 (490 residues), 530.8 bits, see alignment E=1.6e-163 PF13500: AAA_26" amino acids 5 to 228 (224 residues), 75.8 bits, see alignment E=6.2e-25 PF01656: CbiA" amino acids 5 to 228 (224 residues), 81.5 bits, see alignment E=7.6e-27 PF07685: GATase_3" amino acids 253 to 448 (196 residues), 199.4 bits, see alignment E=7.1e-63

Best Hits

Swiss-Prot: 87% identical to COBQ_CITK8: Cobyric acid synthase (cobQ) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K02232, adenosylcobyric acid synthase [EC: 6.3.5.10] (inferred from 87% identity to cko:CKO_00819)

MetaCyc: 84% identical to adenosyl-cobyrate synthase subunit (Salmonella enterica enterica serovar Typhimurium)
Adenosylcobyric acid synthase (glutamine-hydrolyzing). [EC: 6.3.5.10]

Predicted SEED Role

"Cobyric acid synthase (EC 6.3.5.10)" (EC 6.3.5.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7K1 at UniProt or InterPro

Protein Sequence (507 amino acids)

>BWI76_RS23010 cobyric acid synthase CobQ (Klebsiella michiganensis M5al)
MTLAIMLQGTASDVGKSVLVAGLCRIFYQDGQRTAPFKSQNMALNSGITPDGKEMGRAQI
FQAEAAGITPDVRMNPVLLKPTSDRKAQVVLMGKVATDMDAVSYHEYKPRLREQILSVYN
SLAAEHDVLVLEGAGSPAEINLRDRDIVNMGMAEMAQCPVILVADIDRGGVFASIYGTLA
LLHGHERARVKGVIINKFRGDVALLYSGIEQIEALTGVPVLGVMPWLDVDLEDEDGVALQ
KGKYLRTDRRDIEIAVVQLPHIANFTDFNALAAQPDVRVRYVRQPQELAGVDMIILPGSK
NTLGDLRWLRESGMAHAVLQARRHGVPVQGICGGYQMLGETIIDEVESGLGTQPGLGLLN
TVTHFAQHKTTTQVTATLAPGLPAWLAATAGLAVRGYEIHMGETELRDGCRSLMQLHKNG
LSVADGAVSDDGLAFGTYLHGLFDSDEFTRALVNGLRQRKGLAALDSDFEYAQYKSRQFD
LLADAMRQHIDIEKIYAIMRQHQEPIC