Protein Info for BWI76_RS22785 in Klebsiella michiganensis M5al

Annotation: NAD(P)H-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF02719: Polysacc_synt_2" amino acids 4 to 141 (138 residues), 22.5 bits, see alignment E=9.1e-09 PF01370: Epimerase" amino acids 5 to 240 (236 residues), 47.1 bits, see alignment E=3.2e-16 PF07993: NAD_binding_4" amino acids 6 to 237 (232 residues), 119.8 bits, see alignment E=1.8e-38

Best Hits

KEGG orthology group: None (inferred from 86% identity to eae:EAE_01945)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXV5 at UniProt or InterPro

Protein Sequence (369 amino acids)

>BWI76_RS22785 NAD(P)H-binding protein (Klebsiella michiganensis M5al)
MNTLLITGATGFLGGAVLESILNKMNAPNLLLLVRADNSVAAVERIKDNLRKFNISEARL
TALTPHNILLGDLANPQPFLQDPRLNQVTHVLNCAAVASFGNNPLIWKVNVEGTLQFARR
MAQVSGLQRFLHVGTAMSCSPDPDSLVAESTAFRERAEHLVEYTHSKSTIERLMRQECPT
LPLAIARPSIVVGHTHHGCQPSSSIFWVFSMGLMLQKFMCSMEDRIDVIPVDYCADALMM
LLISPLARGEVVHISAGEENSVRFADIDNAMASALEQAPVGDKYAQVSYETLVKMRRELK
TIFGPCNERLMLKAMRLYGAFATLNVRFSNDKLLSMGMPKPPRFTDYIDRCVQTTRGLSI
PQQMAVDFK