Protein Info for BWI76_RS22760 in Klebsiella michiganensis M5al

Annotation: sulfite reductase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 TIGR02041: sulfite reductase (NADPH) hemoprotein, beta-component" amino acids 19 to 558 (540 residues), 989.8 bits, see alignment E=1.4e-302 PF03460: NIR_SIR_ferr" amino acids 81 to 139 (59 residues), 46.5 bits, see alignment 2.5e-16 amino acids 354 to 415 (62 residues), 36.4 bits, see alignment E=3.5e-13 PF01077: NIR_SIR" amino acids 173 to 330 (158 residues), 150.3 bits, see alignment E=3.2e-48

Best Hits

Swiss-Prot: 98% identical to CYSI1_KLEP3: Sulfite reductase [NADPH] hemoprotein beta-component 1 (cysI1) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_01920)

MetaCyc: 94% identical to sulfite reductase, hemoprotein subunit (Escherichia coli K-12 substr. MG1655)
Sulfite reductase (NADPH). [EC: 1.8.1.2]

Predicted SEED Role

"Sulfite reductase [NADPH] hemoprotein beta-component (EC 1.8.1.2)" in subsystem Cysteine Biosynthesis (EC 1.8.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.2

Use Curated BLAST to search for 1.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXM3 at UniProt or InterPro

Protein Sequence (570 amino acids)

>BWI76_RS22760 sulfite reductase subunit beta (Klebsiella michiganensis M5al)
MSEKHPGPLVVEGKLTDAERMKLESNYLRGTIAEDLNDGLTGGFKGDNFLLIRFHGMYQQ
DDRDIRAERAAQKLEPRHAMLLRCRLPGGVITTKQWQAIDKFAGDNTIYGSIRLTNRQTF
QFHGILKKNVKPVHQMLHSVGLDALATANDMNRNVLCTSNPYESQLHAEAYEWAKKISEH
LLPRTRAYAEIWLDQKKVATTDEEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAI
AENGKLVGFNLLVGGGLSIEHGNKKTYARTASEFGYLPVEHTLAVAEAVVTTQRDWGNRT
DRKNAKTKYTLERVGVETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGIDNNWHLTL
FIENGRILDYPGRPLKTGLLKIAKIHKGEFRITANQNLIVASVPEDQKAKIEKLARDHGL
MNAVTPQRENSMACVSFPTCPLAMAEAERFLPSFTDKVEAVMSKHGVGDEHIVTRVTGCP
NGCGRAMLAEVGLVGKAPGRYNLHLGGNRSGTRIPRMYRENITESEILDSIDELVGRWAK
EREAGEGFGDFTVRAGIIRPVLDPARDFWE