Protein Info for BWI76_RS22690 in Klebsiella michiganensis M5al

Annotation: adenylyl-sulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00455: adenylyl-sulfate kinase
  • amino acids 10 to 193 (184 residues), 293.6 bits, E=2.6e-92
• PF01583: APS_kinase
  • amino acids 27 to 177 (151 residues), 236.8 bits, E=1e-74
• PF13671: AAA_33
  • amino acids 30 to 142 (113 residues), 31.6 bits, E=1.9e-11

Best Hits

Swiss-Prot: 96% identical to CYSC_KLEP3: Adenylyl-sulfate kinase (cysC) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 98% identity to eae:EAE_01890)

MetaCyc: 92% identical to adenylyl-sulfate kinase (Escherichia coli K-12 substr. MG1655)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

See A0A285AXL6 at UniProt or InterPro

Protein Sequence (201 amino acids)

>BWI76_RS22690 adenylyl-sulfate kinase (Klebsiella michiganensis M5al)
MARHDENVVWHAHPVTQEQREQHHGHRGVVLWFTGLSGSGKSTVAGALEEALHRLGVSTY
LLDGDNVRHGLCSDLGFSDDDRKENIRRVGEVAKLMVDAGLVVLTAFISPHRAERQMVRE
RLGEGRFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYESPERAEIHLDGEQ
LVTNLVHQLLDLLRQSDIIRS