Protein Info for BWI76_RS22635 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 203 to 229 (27 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 296 to 321 (26 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 367 to 386 (20 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 346 (335 residues), 158.8 bits, see alignment E=9.3e-51 amino acids 228 to 383 (156 residues), 42.6 bits, see alignment E=1.9e-15

Best Hits

KEGG orthology group: None (inferred from 72% identity to kva:Kvar_0964)

Predicted SEED Role

"Possible membrane transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXS4 at UniProt or InterPro

Protein Sequence (404 amino acids)

>BWI76_RS22635 MFS transporter (Klebsiella michiganensis M5al)
MTYRSKVATVFLLGFFLDLINMFIASVAFPAMGRTLHASVGELAWVSNGYIAGLTLVLPF
SAWLSQQFGARRVFLLSLSLFSLGALAAGMADSLISLVMWRALQGMGGGLLIPPGQALTW
QQFKPHERAKLSAAVMLVGLLAPACSPALGGALVQSLSWRWVFFASLPIALLTFGLAALW
LRDEKSVARSGGFLHLSLLRDPLLRFSMLVYLCVPGTFIGINVVGMFYLQSVTGMAPSAI
GSLMLPWSLASFVAIATTGRYFNRLGPRPLIALGCLLQAAGILILAGVNAHTASSALIAA
FILMGAGGSLCSSTAQSSAFLNVANPDMPDASALWNLNRQLSFLIGSALLAALLSAFLLY
WPTPLAWRGVFIAAAVLTLVPLLGCLKFDNRALIMRLHGKMENK