Protein Info for BWI76_RS22620 in Klebsiella michiganensis M5al

Annotation: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02441: Flavoprotein" amino acids 1 to 173 (173 residues), 148.4 bits, see alignment E=7e-48 TIGR00421: polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases" amino acids 2 to 183 (182 residues), 243.1 bits, see alignment E=8.4e-77

Best Hits

Swiss-Prot: 88% identical to PADL_ECOLX: Probable UbiX-like flavin prenyltransferase (ecdB) from Escherichia coli

KEGG orthology group: None (inferred from 92% identity to eae:EAE_01825)

MetaCyc: 90% identical to protocatechuate/4-hydroxybenzoate decarboxylase accessory subunit (Klebsiella pneumoniae pneumoniae)
Protocatechuate decarboxylase. [EC: 4.1.1.63]

Predicted SEED Role

"Hydroxyaromatic non-oxidative decarboxylase protein B (EC 4.1.1.-)" (EC 4.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXK8 at UniProt or InterPro

Protein Sequence (197 amino acids)

>BWI76_RS22620 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (Klebsiella michiganensis M5al)
MKLIVGMTGATGAPLGVALLKALREMPEVETHLVMSKWAKTTIELETPYSAREVAALADF
SHSPADQAAIISSGSFRTDGMIVIPCSMKTLAGIRAGYAEGLVGRAADVVLKEGRKLVLV
PREMPLSTIHLENMLALSRMGVAMVPPMPAYYNHPKTIEDVTDHVVTRVLDQFGLEYHKA
RRWSGLRAVESISQENE