Protein Info for BWI76_RS22395 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details amino acids 133 to 158 (26 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 219 to 262 (44 residues), see Phobius details amino acids 277 to 277 (1 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 333 to 333 (1 residues), see Phobius details amino acids 335 to 336 (2 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 389 to 407 (19 residues), see Phobius details TIGR00410: PTS system, lactose/cellobiose family IIC component" amino acids 17 to 421 (405 residues), 310.8 bits, see alignment E=8.4e-97 PF02378: PTS_EIIC" amino acids 34 to 349 (316 residues), 159.6 bits, see alignment E=5.2e-51

Best Hits

KEGG orthology group: K02761, PTS system, cellobiose-specific IIC component (inferred from 93% identity to kpu:KP1_4340)

Predicted SEED Role

"PTS system, cellobiose-specific IIC component (EC 2.7.1.69)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXM1 at UniProt or InterPro

Protein Sequence (423 amino acids)

>BWI76_RS22395 hypothetical protein (Klebsiella michiganensis M5al)
MNIQLMNVAVDIIEQRLAPLANVLTRNNHITAMRDSFALAMPFVIVGSLLVPILFPPVSI
DGASFFGQFYFQLRPILLPTFELTIGLVALIVAFGASASLAKQYRLPERLCGLTGCLAFL
LFIGFRGNGAANLYLGGMGIFTALISSTYSIEIVRFFYKKGWCIRLPEEVPVMTRNGFQL
LIPLLVVMLSISVINALLLQSTGRILPELISEAVRPLVVASDTLTAVLISLFICNLLWFV
GIHGALIITGIMNPFWMTYLFENQQALAAGSATLPHIYLQGFWDFYLLIGGIGSTLPLVF
MAMRSRSRQLKSVGKIGLLPSLFNINEPILFGFPIIMNPVFLLPFLFVPLINACIAWYLT
QLGILDRAVAMLPWSMPAPLGAAWSANGSWKNLCMCLFAIFNAWMLYRPFFKVYERQLAD
AER