Protein Info for BWI76_RS22275 in Klebsiella michiganensis M5al

Annotation: carbamoyltransferase HypF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 739 PF00708: Acylphosphatase" amino acids 5 to 72 (68 residues), 56 bits, see alignment E=1e-18 TIGR00143: carbamoyltransferase HypF" amino acids 6 to 733 (728 residues), 900.8 bits, see alignment E=3.3e-275 PF07503: zf-HYPF" amino acids 103 to 136 (34 residues), 63.4 bits, see alignment (E = 3.4e-21) amino acids 153 to 183 (31 residues), 52.6 bits, see alignment (E = 8e-18) PF01300: Sua5_yciO_yrdC" amino acids 205 to 368 (164 residues), 128.4 bits, see alignment E=5.3e-41 PF17788: HypF_C" amino acids 386 to 481 (96 residues), 109.4 bits, see alignment E=3e-35 PF22521: HypF_C_2" amino acids 494 to 729 (236 residues), 217.6 bits, see alignment E=5.8e-68

Best Hits

Swiss-Prot: 75% identical to HYPF_ECOLI: Carbamoyltransferase HypF (hypF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 81% identity to eae:EAE_01610)

MetaCyc: 75% identical to carbamoyl--[HypE] ligase (Escherichia coli K-12 substr. MG1655)
6.2.1.-

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypF" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (739 amino acids)

>BWI76_RS22275 carbamoyltransferase HypF (Klebsiella michiganensis M5al)
MNGVQIRIRGKVQGVGFRPFVWQLAQQLGVRGDVCNDGDGVLVRLVGDDAAFLSALTRRC
PPLARIDSTETQPFVWAVAPLNFTIRQSGAGSMRTQIVPDAATCPACLAEMNNPQDRRYR
YPFINCTHCGPRFTIIRAMPYDRPLTAMSPFPLCPACAAEYRHPADRRFHAQPVACAECG
PLLEWRGPKGHLFGEAALDAAITRLRAGDIVAVKGLGGFHLVCDAGNRAAVATLRARKHR
PAKPLAVMLANTAGLPERAIKLLASPAAPIVLLDKAQVAGLCDLIAPGLAEVGGMLPSNP
LQHLLSQALARPLVMTSGNLSGRQPALTNEDALADLAAIADGFLLHNREIVQRMDDSVVR
QSGEMLRRARGYVPDALALPPGFCDAPPLLALGAEMKNTFCLLRGDEAVLSQHFGDLDEE
GVEAQWRQALRLMQEIYAFTPQRVVADAHPGYRASRWAASLMLPVERVLHHHAHAAACLA
EHRWPLEGGDVIALTLDGIGMGENGELWGGECLRVNYRECEYLGGLPSVALPGGDLAARQ
PWRNLLAHCLAFVPEWQNYADTAALRQQNWPLLARAIERGINAPQASSCGRLFDAVACAL
GCAPLALSYEGEAACRLEALAATCEGVDHPVTLPWREGKLDLATFWRQWLSWQAGPAQKA
WAFHDALARGLAAMMRDCANARNIHTLAFGGGVLHNRLLTARLTFYLADFTLLFPQQLPA
GDGAIALGQAIVAAARLQA