Protein Info for BWI76_RS22265 in Klebsiella michiganensis M5al

Annotation: NADH:flavorubredoxin oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF07992: Pyr_redox_2" amino acids 5 to 275 (271 residues), 184.6 bits, see alignment E=1.3e-57 PF13738: Pyr_redox_3" amino acids 65 to 272 (208 residues), 52.6 bits, see alignment E=1.9e-17 PF13434: Lys_Orn_oxgnase" amino acids 91 to 169 (79 residues), 24.8 bits, see alignment E=5.1e-09 PF00070: Pyr_redox" amino acids 143 to 220 (78 residues), 67.5 bits, see alignment E=5.5e-22 PF18113: Rbx_binding" amino acids 306 to 375 (70 residues), 68.8 bits, see alignment E=1.3e-22

Best Hits

Swiss-Prot: 90% identical to NORW_KLEP3: Nitric oxide reductase FlRd-NAD(+) reductase (norW) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K12265, nitric oxide reductase FlRd-NAD(+) reductase [EC: 1.18.1.-] (inferred from 90% identity to kpe:KPK_1080)

MetaCyc: 76% identical to NADH:flavorubredoxin reductase (Escherichia coli K-12 substr. MG1655)
Rubredoxin--NAD(+) reductase. [EC: 1.18.1.1]

Predicted SEED Role

"Nitric oxide reductase FlRd-NAD(+) reductase (EC 1.18.1.-)" in subsystem Nitrosative stress (EC 1.18.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.- or 1.18.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXG6 at UniProt or InterPro

Protein Sequence (377 amino acids)

>BWI76_RS22265 NADH:flavorubredoxin oxidoreductase (Klebsiella michiganensis M5al)
MSDGIVIIGSGFAARQLVKNIRKQDPNIPLTLIAADSMDEYNKPDLSHVVSRGQNADDLT
LQTAGEFAEQYNLRLFPHTWVSDIDADNQVVKSQDREWRYDKLVLATGATPFIPLVPGRE
LMLTLNSQREYGAAQSQLRDAKRVLIVGGGLIGCELAMDFCRAGKAVTVVDNSASVLSAL
MPPEASSRLQHRLTDMGVDLMLKSQLQSLAQNADGIRVTLDRQRTLTVDAVVAAAGLRPE
TALARHAGLQTHRGVVVNSQLQTSHPAIYALGDCAEINGMVLPFLQPILLSAMCLGKNLL
TQQGELKLPPMLVKVKTPDLPLHLAGDTRREDLTWHIVAAKDGLVAKGVDAENQLRAFVV
SEDRMKDAFALLKQLVS