Protein Info for BWI76_RS22235 in Klebsiella michiganensis M5al
Annotation: transcriptional regulator GutM
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 77% identical to GUTM_ECOLI: Glucitol operon activator protein (gutM) from Escherichia coli (strain K12)
KEGG orthology group: K02466, glucitol operon activator protein (inferred from 92% identity to kpe:KPK_1085)Predicted SEED Role
"Glucitol operon activator protein" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AXF6 at UniProt or InterPro
Protein Sequence (119 amino acids)
>BWI76_RS22235 transcriptional regulator GutM (Klebsiella michiganensis M5al) MVTALITVAAIAWITQLAFGGWQIRQFNRAFDRLCQQGRVGVGRSSGRFKPRAVVAIAVD EDDRIRDTLLMKGLTVFARPRKIPALHGKHLKELQPDVIFPNDPLCQNALSLALNPKHG