Protein Info for BWI76_RS22085 in Klebsiella michiganensis M5al

Annotation: L-valine transporter subunit YgaH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 69 to 85 (17 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details PF05437: AzlD" amino acids 6 to 104 (99 residues), 46.4 bits, see alignment E=1.8e-16

Best Hits

Swiss-Prot: 70% identical to YGAH_ECOLI: Uncharacterized protein YgaH (ygaH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 81% identity to kva:Kvar_1056)

MetaCyc: 70% identical to L-valine exporter, YgaH component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-269

Predicted SEED Role

"Branched-chain amino acid transport, AzlD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXE1 at UniProt or InterPro

Protein Sequence (111 amino acids)

>BWI76_RS22085 L-valine transporter subunit YgaH (Klebsiella michiganensis M5al)
MNSDVLTIGVVVGCVNYLFRYLPLRLRADNARPTRRGPIGVLLDTIGIASICALLVVSSV
PEILHDARRLLPTLAGFAVLGLAFWKTRSIILPTLLSALTYGVVWKIGLWL