Protein Info for BWI76_RS21900 in Klebsiella michiganensis M5al

Annotation: amino acid ABC transporter permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 16 to 45 (30 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 115 (101 residues), 64 bits, see alignment E=7.2e-22 PF00528: BPD_transp_1" amino acids 35 to 217 (183 residues), 49.7 bits, see alignment E=5.6e-17 PF00005: ABC_tran" amino acids 276 to 429 (154 residues), 117.8 bits, see alignment E=8.5e-38

Best Hits

KEGG orthology group: None (inferred from 87% identity to kpe:KPK_1154)

Predicted SEED Role

"glutamine ABC transporter ATP-binding component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXA5 at UniProt or InterPro

Protein Sequence (506 amino acids)

>BWI76_RS21900 amino acid ABC transporter permease/ATP-binding protein (Klebsiella michiganensis M5al)
MEFDWGYFFSLFSVGAFWQACVTVVVVSSLSWFIGLILGFLLACAKLSGPRWLKVPVELY
IWFFRSVPLMVLLVFVYNLPQLFPATQPLLGIPFIAGLVSMTVTEAAYMAEIHRGGLLSV
AKGQSEAGHALSFSFIGVQRLIIIPQAFRISLPTLINEYITIIKLSSILSVISLPELLLT
GQRLYAQNFLVMETLLAVAVYYVMVVTVFTWLFRGLENLLDIQRKRPQTLNESECATLRQ
NLKPPVQMQKAQAASGNPPALDLHAIEKSWGQHHVLKGIDLKVENGEVISIIGPSGSGKT
TLIRTINALESIDGGEIILYGEDYLKGASVVDKQQMRAGVRRIGMVFQGFNLFPHRTVLD
NVMLAPLYHKLLDRAAAREQALWLLDRVGLLAHAEKYPYQLSGGQQQRVAIARALALKPD
IMLFDEPTSALDPELVGEVLKVIQSLAREGMTMIIVTHEMDFALSISDRVVMMENGVVQS
DMPPQRIRNDVADPSLTRIREFMGVQ