Protein Info for BWI76_RS21835 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF21446: Gp34_trimer" amino acids 23 to 85 (63 residues), 52.9 bits, see alignment E=5.2e-18 PF13884: Peptidase_S74" amino acids 270 to 320 (51 residues), 55.1 bits, see alignment 7.8e-19

Best Hits

KEGG orthology group: None (inferred from 75% identity to spe:Spro_0533)

Predicted SEED Role

"Long tail fiber protein p37"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>BWI76_RS21835 hypothetical protein (Klebsiella michiganensis M5al)
MAEQQKNAQVLNGINDDITELKSLTTLRKRVVSDGEIVSKSANGFRLSNGSTGVILRNDG
RDFYALTTAAGQSQDGQWNTLRPFSFSLSTGRVSLRNGVDISGGAVVSHNAGISTSLTGP
DPLINGQTYDAAPVYTDFTTGKVTTRMMMGARVNAGRDDFGILSYRDWHGKWHELRLRPN
AELDAGQFIKRNPDGWFWAGGNKNISSTERVTNGVHLQGASDLAADFYHQERIGQHHFLG
LHVANGGAQGWYEFRNDGHAYTNGAWSSSSDSRMKTDIEKIDNALDRLHRIGGYTYLKQG
KPEAGVIAQEVEAVLPQAVTQTTLTLNDGSVLPDARSININGVVALLVEALKEERQALVH
EKEARLSLEQRLASLEERVGREG