Protein Info for BWI76_RS21705 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 345 (322 residues), 98.5 bits, see alignment E=2e-32

Best Hits

Swiss-Prot: 54% identical to NIMT_ECOLI: 2-nitroimidazole transporter (nimT) from Escherichia coli (strain K12)

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 99% identity to kpe:KPK_B0063)

MetaCyc: 54% identical to 2-nitroimidazole exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-273; TRANS-RXN0-596

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>BWI76_RS21705 MFS transporter (Klebsiella michiganensis M5al)
MSHTTNKWSSIILVIGILFIAINLRVPFTAIAPVLESIRHDFGLSITAVGLLNSLPLLAF
AAFSPLSASISRKYGLERTLFGALVVISAGIVLRSTDSVWALYGGTVLIGIGIALGNVLL
PGLIKRDFSGNVASVTGAYSITMGTAGAIGSTIVIPLTQSWGWNIALAMLVIAPLLAMLL
WLPQLKKKHQLPVAGEKKAATVAVWRSSLAWQVTMFMGLNAMPFYVAVGWLPVILTGSGL
SSAQAGEVHGILQLTTAIPGLILAATLRRLNDQKLAAAGVSLLTAVSFIGILYLPNLAML
WAALLGFGSGASMMLGLTFIGLRTTNAGDAAALSGMAQSIGYLMAAMGPLLLGKVQELSG
GWTVPLLMTTAISVAGACTGMAAGRDVHLEPLQQPG