Protein Info for BWI76_RS21520 in Klebsiella michiganensis M5al

Annotation: ribosome maturation factor RimM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 TIGR02273: 16S rRNA processing protein RimM" amino acids 14 to 182 (169 residues), 205.3 bits, see alignment E=2.1e-65 PF01782: RimM" amino acids 16 to 96 (81 residues), 95.7 bits, see alignment E=2.5e-31 PF05239: PRC" amino acids 104 to 177 (74 residues), 40.4 bits, see alignment E=3.7e-14 PF24986: PRC_RimM" amino acids 108 to 181 (74 residues), 46.1 bits, see alignment E=4.6e-16

Best Hits

Swiss-Prot: 96% identical to RIMM_KLEP7: Ribosome maturation factor RimM (rimM) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K02860, 16S rRNA processing protein RimM (inferred from 95% identity to kpe:KPK_1189)

Predicted SEED Role

"16S rRNA processing protein RimM" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AX93 at UniProt or InterPro

Protein Sequence (182 amino acids)

>BWI76_RS21520 ribosome maturation factor RimM (Klebsiella michiganensis M5al)
MSKQHTAQAPVEPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQVVEL
ESWRHHNQDIVIKLKGIDDRDAANLLTNCEIVVDSSQLPALEEGDYYWKDLMGCQVVTTE
GYGLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDP
GF