Protein Info for BWI76_RS21520 in Klebsiella michiganensis M5al
Annotation: ribosome maturation factor RimM
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 96% identical to RIMM_KLEP7: Ribosome maturation factor RimM (rimM) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
KEGG orthology group: K02860, 16S rRNA processing protein RimM (inferred from 95% identity to kpe:KPK_1189)Predicted SEED Role
"16S rRNA processing protein RimM" in subsystem Ribosome biogenesis bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AX93 at UniProt or InterPro
Protein Sequence (182 amino acids)
>BWI76_RS21520 ribosome maturation factor RimM (Klebsiella michiganensis M5al) MSKQHTAQAPVEPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQVVEL ESWRHHNQDIVIKLKGIDDRDAANLLTNCEIVVDSSQLPALEEGDYYWKDLMGCQVVTTE GYGLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDP GF