Protein Info for BWI76_RS21460 in Klebsiella michiganensis M5al
Annotation: translation inhibitor protein RaiA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 92% identical to YFIA_ECOL6: Ribosome-associated factor Y (yfiA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: K05809, ribosome-associated inhibitor A (inferred from 99% identity to kpn:KPN_02919)Predicted SEED Role
"Ribosome hibernation protein YfiA" in subsystem Ribosome activity modulation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AX08 at UniProt or InterPro
Protein Sequence (111 amino acids)
>BWI76_RS21460 translation inhibitor protein RaiA (Klebsiella michiganensis M5al) MTMNITSKQMEITPAIRQHVADRLAKLDKWQTHLINPHIILSKEPQGFVADATINTPNGH LVASARHEDMYAAINELINKLERQLNKVQHKGEARRAATSVKEAGFVEEEE