Protein Info for BWI76_RS21450 in Klebsiella michiganensis M5al

Annotation: 23S rRNA pseudouridine(1911/1915/1917) synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR00005: pseudouridine synthase, RluA family" amino acids 13 to 313 (301 residues), 359 bits, see alignment E=1e-111 PF01479: S4" amino acids 18 to 65 (48 residues), 39.4 bits, see alignment 3.9e-14 PF00849: PseudoU_synth_2" amino acids 92 to 242 (151 residues), 107 bits, see alignment E=1.1e-34

Best Hits

Swiss-Prot: 93% identical to RLUD_SALTY: Ribosomal large subunit pseudouridine synthase D (rluD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_01035)

MetaCyc: 91% identical to 23S rRNA pseudouridine1911/1915/1917 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11837 [EC: 5.4.99.23]

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase D (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AX52 at UniProt or InterPro

Protein Sequence (326 amino acids)

>BWI76_RS21450 23S rRNA pseudouridine(1911/1915/1917) synthase (Klebsiella michiganensis M5al)
MAQRVQLNATVSENQLGQRLDQALAELFPDYSRSRIKEWILDQRVLVNGCVSDKPKEKVL
GGETIAIDVEIEEEVRFQPQDIPLNIVYEDDDILVINKPRDLVVHPGAGNPDGTVLNALL
HYYPAIADVPRAGIVHRLDKDTTGLMVVAKTIPAQTRLVESLQLREITREYEAVAIGHMT
AGGTVEEPISRHPTKRTHMAVHPMGKPAVTHYRIMEHFRIHTRLRLRLETGRTHQIRVHM
AHITHPLVGDQVYGGRPRPPKGASEEFITALRKFDRQALHATMLRLYHPISGIEMEWHAP
IPQDMVDLIDAMRADFETHKDDIDWL