Protein Info for BWI76_RS21400 in Klebsiella michiganensis M5al

Annotation: protein lysine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 892 PF13380: CoA_binding_2" amino acids 13 to 130 (118 residues), 77.4 bits, see alignment E=3.7e-25 PF13607: Succ_CoA_lig" amino acids 147 to 280 (134 residues), 152.3 bits, see alignment E=2.1e-48 PF13549: ATP-grasp_5" amino acids 473 to 694 (222 residues), 253.4 bits, see alignment E=4.8e-79 PF13302: Acetyltransf_3" amino acids 725 to 863 (139 residues), 38.2 bits, see alignment E=7.2e-13 PF00583: Acetyltransf_1" amino acids 759 to 863 (105 residues), 46.9 bits, see alignment E=9.2e-16

Best Hits

Swiss-Prot: 87% identical to LYSAC_SALTY: Peptidyl-lysine N-acetyltransferase Pat (pat) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_01005)

MetaCyc: 86% identical to peptidyl-lysine N-acetyltransferase (Escherichia coli K-12 substr. MG1655)
2.3.1.-

Predicted SEED Role

"Protein acetyltransferase" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7T5 at UniProt or InterPro

Protein Sequence (892 amino acids)

>BWI76_RS21400 protein lysine acetyltransferase (Klebsiella michiganensis M5al)
MSQRGLEALLRPKSIAVIGASMKPQRAGYLMMRNLLAGGFNGPVLPVTPAWKAVQGVLAW
PDVDSLPFTPDLAVLCTNARRNLELLEALGQKGCKTCIILSSIPEQYPALLECAARYQMR
LLGPNSLGLLAPWQGLNASFSPVPIHRGKLAFISQSAAVSNTILDWAQQREMGFSYFIAL
GDSLDIDVDDLLDFLARDSKTSAILLYLEHLSDARRFVSAARSASRNKPILVIKSGRSPA
AQKLLHVNSGMDPAWDAAIQRAGLLRVQDTHELFSAVETLSHMRPLRGEKLMIISNGAAP
AALALDELWLRNGKLAALSEETSSALRQALPETIAIANPLDLRDDASSEHYLKALNILLD
SHDYDALLVIHSPSAAAPGTESALALIDALKRHPRGKYVTVLTNWCGEFSSQEARRLFSD
AGLPTYRTPEGTITAFMHMVEYRRNQKQLRETPVLSDSLTTNTAEAHSLLQRAMNEGATS
LDTHEVSPVLRAYGIHTLPTWIAADSAEAVHIAEQIGYPVALKLRSPDIPHKSEVQGVML
YLRTATEVQQAADAIFDRVKMTWPQARIHGLLVQSMANRAGAQELRVVVEHDPVFGPLIM
LGEGGVEWRAEDQAAVALPPLNMNLARYLVIQAIKSKKVRGRSALRPLDIPGLSQLLVQV
SNLIVDCPEIQRLDIHPLLASGHEFTALDVTLTLAPFTGDSESRLAIRPYPQQQEEWVVM
KNGERCLFRPILPEDEPQLMAFIAQVTKEDLYYRYFSEINEFTHDDLANMTQIDYDREMA
FVAVRTTAEGDEILGVTRAISDPDNIDAEFAVLVRSDLKGMGLGRKLLEKLIAYTQNHGL
QRLNGITMPNNKGMIGLARKLGFSVDIQLEDGIVSLSLQLVPEQLQTAGRNC