Protein Info for BWI76_RS21285 in Klebsiella michiganensis M5al

Annotation: HAD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01545: HAD hydrolase, family IF
  • amino acids 4 to 211 (208 residues), 404.6 bits, E=4.9e-126
• PF12710: HAD
  • amino acids 9 to 192 (184 residues), 54.1 bits, E=1.4e-18

Best Hits

Swiss-Prot: 78% identical to PGPC_SHIFL: Phosphatidylglycerophosphatase C (pgpC) from Shigella flexneri

KEGG orthology group: None (inferred from 83% identity to eae:EAE_00880)

MetaCyc: 78% identical to phosphatidylglycerophosphatase C (Escherichia coli K-12 substr. MG1655)
Phosphatidylglycerophosphatase. [EC: 3.1.3.27]

Predicted SEED Role

"Hypothetical protein, similar to phosphoserine phosphatase"

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (11/12 steps found)
• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• cardiolipin biosynthesis I (3/3 steps found)
• cardiolipin biosynthesis II (3/3 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• cardiolipin biosynthesis III (2/3 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.27

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

See A0A285B7N1 at UniProt or InterPro

Protein Sequence (211 amino acids)

>BWI76_RS21285 HAD family hydrolase (Klebsiella michiganensis M5al)
MNSSTRRVVFFDLDGTLHQQDMFGSFLRYILRHQPLNALLVLPLLPVIAAGLMLYGRAAR
WPMSLLLWASTFGRSEHHLKRLEADFVRWFRQHVTAFPVVQSRLNHYLSSTDADVWLITG
SPQSLVEQVYFDTAWLPRVNLIASRMERRCGGWGLTLRCLGNEKVAQLEQKIGAPLRLYS
GYSDSEQDNPLLNFCQHRWRVTPQGDLQQLE