Protein Info for BWI76_RS20985 in Klebsiella michiganensis M5al

Annotation: glycosyl hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 345 to 362 (18 residues), see Phobius details PF07470: Glyco_hydro_88" amino acids 28 to 361 (334 residues), 302.4 bits, see alignment E=2.1e-94

Best Hits

KEGG orthology group: None (inferred from 80% identity to eae:EAE_00610)

Predicted SEED Role

"Rhamnogalacturonides degradation protein RhiN" in subsystem D-Galacturonate and D-Glucuronate Utilization or L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7Z1 at UniProt or InterPro

Protein Sequence (365 amino acids)

>BWI76_RS20985 glycosyl hydrolase family protein (Klebsiella michiganensis M5al)
MSQKISHPELILLIEKLIDSLTAIQDDSGQFLQRLPDGRVIDTKGWAGWEWTHGIGLFGL
YRYHELTGSSRARQIIDDWFSARFAEGTPEKNINTAIPFLTLAGRYQQDARHEWRAYLEV
WGDALYRQIPRTDEGCMQHVTYENAHYQQIWDDTLMMAILPLARLGLLLQKPYWVEEAKF
QFLQHLHYLTDRKSGLWFHGWNFNGRHHFAGALWARGNSWITLAIPELLEMLNLDEHDAF
YRQLCNILQGQVSALARCQCENGLWPTLLDDATSYAEASATGGFAAGILKAIRLGYLDDR
YLPVAERAIAGIIKHISPEGELTQVSFGTAMGHDLDHYRRIPLTAMPYGQALAILSLVEA
LYRTR