Protein Info for BWI76_RS20850 in Klebsiella michiganensis M5al

Annotation: oxidoreductase FeS-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13247: Fer4_11
  • amino acids 55 to 144 (90 residues), 40 bits, E=3.1e-13
• PF12797: Fer4_2
  • amino acids 80 to 99 (20 residues), 27.6 bits, see alignment (E = 1.5e-09)
• PF12837: Fer4_6
  • amino acids 80 to 101 (22 residues), 28.5 bits, see alignment (E = 8.7e-10)
• PF00037: Fer4
  • amino acids 81 to 101 (21 residues), 29.7 bits, see alignment (E = 3.2e-10)
• PF13237: Fer4_10
  • amino acids 81 to 138 (58 residues), 28.2 bits, 1.3e-09
• TIGR01318: glutamate synthase, small subunit
  • amino acids 184 to 648 (465 residues), 829 bits, E=4.6e-254
• PF14691: Fer4_20
  • amino acids 199 to 310 (112 residues), 127.4 bits, E=1.8e-40
• PF07992: Pyr_redox_2
  • amino acids 324 to 635 (312 residues), 81.9 bits, E=4.4e-26
• PF01494: FAD_binding_3
  • amino acids 325 to 355 (31 residues), 22 bits, see alignment (E = 7.1e-08)
• PF13450: NAD_binding_8
  • amino acids 327 to 361 (35 residues), 33 bits, see alignment (E = 4.7e-11)
• PF00070: Pyr_redox
  • amino acids 465 to 540 (76 residues), 25.2 bits, E=1.6e-08

Best Hits

KEGG orthology group: None (inferred from 81% identity to eae:EAE_00480)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

See A0A285B7A4 at UniProt or InterPro

Protein Sequence (654 amino acids)

>BWI76_RS20850 oxidoreductase FeS-binding subunit (Klebsiella michiganensis M5al)
MNHFILSDSHKCIGCKACEVACVMAHNDEQHVLTPQRFLPRITVIKREQKRNAVTCHHCE
GAPCARSCPNGAISQFNDSVLVNQEKCIGCKSCMVACPFGVMQIVLTPVEEGRVKATAHK
CDLCDGREEGPACVQNCPAEALQLATDSTLLNLAKQRRQRAARLGHPGAAVLACSAGKVA
QMEATPPRGEPDKLSAETRKANFDEIYLPFSAGQANREAERCLKCGEHSICEWTCPLHNH
IPQWIERVKEGDISAAVELSHQTNCLPEITGRVCPQDRLCEGACTLRDEHGSVTIGNIER
YISDQALANGWRPDLSQVVESGKRVAIIGAGPAGLACADRLVRNGVSPVVFDRHPEIGGL
LTFGIPAFKLDKSLLARRREIFTQMGVRFELNCEIGKDIPLTTLLDDYDAVFIGAGTYRS
MKADLPNEDAPGVYDALPFLIANTKQVMGLLELPEEPYVNTEGLNVVVLGGGDTAMDCVR
TALRHGAKQVTCAYRRDEANMPGSKKEVKNAREEGAQFEFNVQPVTLELNEEGHVNGVRF
LRTRLGAPDAQGRRSPSPIPGSEFVMPADAVIMAFGFHPHGMPWLESVGVKLDSRGRIKA
NVESRYRYQTTHRKVFAGGDAVRGADLVVTAMAEGRHAAQGIMDFLGVKSIPLH