Protein Info for BWI76_RS20815 in Klebsiella michiganensis M5al

Annotation: ethanolamine utilization protein EutQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06249: EutQ
  • amino acids 82 to 229 (148 residues), 218 bits, E=5.3e-69
• PF05899: Cupin_3
  • amino acids 154 to 208 (55 residues), 32.5 bits, E=5.8e-12

Best Hits

Swiss-Prot: 85% identical to EUTQ_ECOLI: Ethanolamine utilization protein EutQ (eutQ) from Escherichia coli (strain K12)

KEGG orthology group: K04030, ethanolamine utilization protein EutQ (inferred from 87% identity to cko:CKO_00335)

MetaCyc: 85% identical to acetate kinase (Salmonella enterica enterica serovar Typhimurium str. LT2)
Acetate kinase. [EC: 2.7.2.1, 2.7.2.15]

Predicted SEED Role

"Ethanolamine utilization protein EutQ" in subsystem Ethanolamine utilization

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (22/22 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• superpathway of L-threonine metabolism (18/18 steps found)
• mixed acid fermentation (16/16 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
• Bifidobacterium shunt (13/15 steps found)
• L-threonine degradation I (6/6 steps found)
• (S)-propane-1,2-diol degradation (5/5 steps found)
• ethanolamine utilization (5/5 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• pyruvate fermentation to acetate I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to acetate VII (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (7/9 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• glycine degradation (reductive Stickland reaction) (1/2 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (5/8 steps found)
• methanogenesis from acetate (2/6 steps found)
• gallate degradation III (anaerobic) (5/11 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (9/17 steps found)
• L-lysine fermentation to acetate and butanoate (3/10 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)
• superpathway of methanogenesis (2/21 steps found)
• superpathway of L-lysine degradation (12/43 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.1

Use Curated BLAST to search for 2.7.2.1 or 2.7.2.15

Sequence Analysis Tools

See A0A285B7F7 at UniProt or InterPro

Protein Sequence (230 amino acids)

>BWI76_RS20815 ethanolamine utilization protein EutQ (Klebsiella michiganensis M5al)
MKKLITANDIRAAHARGEAEISVVLRASIITPEAREVAELLGVAIRECDESAPEPAAPAA
EDKTESQRIRETIIAQLPEGQFTESLVAQLMEKVMKEKQSLGMDAMQPSFKAVTGKGGVK
VIDGGSVKFGRFDGAEPHRVGLTDLITEQDGSSMAAGFMQWENAFFPWTLNYDEVDMVLE
GELHVRHEGETMVAKAGDVMFIPKGSSIEFGTPSTVRFMYVAWPANWQSL