Protein Info for BWI76_RS20795 in Klebsiella michiganensis M5al

Annotation: ethanolamine catabolic microcompartment shell protein EutN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03319: EutN_CcmL" amino acids 1 to 83 (83 residues), 102.8 bits, see alignment E=5.8e-34

Best Hits

Swiss-Prot: 90% identical to EUTN_SALTY: Ethanolamine utilization protein EutN (eutN) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04028, ethanolamine utilization protein EutN (inferred from 94% identity to cro:ROD_24041)

Predicted SEED Role

"Ethanolamine utilization polyhedral-body-like protein EutN" in subsystem Ethanolamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7K8 at UniProt or InterPro

Protein Sequence (95 amino acids)

>BWI76_RS20795 ethanolamine catabolic microcompartment shell protein EutN (Klebsiella michiganensis M5al)
MKLAVVTGHIVCTVRHQGLAHDKLLMVEMIDAAGKPDGQCAVATDSIGAGAGEWVLLVSG
SSARQAHRSEASPVDLCVIGIVDEAVAGGQVIFHK