Protein Info for BWI76_RS20785 in Klebsiella michiganensis M5al

Annotation: ethanolamine utilization protein EutJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 TIGR02529: ethanolamine utilization protein EutJ family protein" amino acids 34 to 268 (235 residues), 365.9 bits, see alignment E=4.3e-114 PF11104: PilM_2" amino acids 140 to 244 (105 residues), 28.8 bits, see alignment E=9.5e-11 PF14450: FtsA" amino acids 142 to 246 (105 residues), 37.7 bits, see alignment E=3.8e-13

Best Hits

Swiss-Prot: 94% identical to EUTJ_SALTY: Ethanolamine utilization protein EutJ (eutJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04024, ethanolamine utilization protein EutJ (inferred from 94% identity to spq:SPAB_00491)

Predicted SEED Role

"Ethanolamine utilization protein EutJ" in subsystem Ethanolamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B767 at UniProt or InterPro

Protein Sequence (279 amino acids)

>BWI76_RS20785 ethanolamine utilization protein EutJ (Klebsiella michiganensis M5al)
MAHDEQRWLTPRLQKAAVLCNQTPALSGSPLWLGVDLGTCDVVSMVVDGDGQPVAVCLDW
ADVVRDGIVWDFFGAVTIVRRHLDALERQLGCRFTHAATSFPPGTDPRISINVLESAGLE
VSHVLDEPTAVADLLQLDNAGVVDIGGGTTGIAIVKRGKVTYSADEATGGHHISLTLAGN
RRIPLEEAEQYKRSNAQEIWPVVKPVYEKMAEIVARHIEGQGIADLWLAGGSCMQPGVDA
LFRKRFPELQVHLPQHSLFMTPLAIASSGREKAEGINAS