Protein Info for BWI76_RS20725 in Klebsiella michiganensis M5al

Annotation: GNAT family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 PF00583: Acetyltransf_1" amino acids 17 to 123 (107 residues), 80.6 bits, see alignment E=3.3e-26 PF13673: Acetyltransf_10" amino acids 33 to 129 (97 residues), 49.1 bits, see alignment E=1.7e-16 PF13480: Acetyltransf_6" amino acids 38 to 107 (70 residues), 32.5 bits, see alignment E=2.6e-11 PF13508: Acetyltransf_7" amino acids 43 to 124 (82 residues), 61.7 bits, see alignment E=2.2e-20 PF08445: FR47" amino acids 67 to 127 (61 residues), 33.9 bits, see alignment E=7.7e-12

Best Hits

Swiss-Prot: 93% identical to YPEA_SALTY: Acetyltransferase YpeA (ypeA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 92% identity to eoj:ECO26_3486)

Predicted SEED Role

"Acetyltransferase YpeA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7U0 at UniProt or InterPro

Protein Sequence (141 amino acids)

>BWI76_RS20725 GNAT family acetyltransferase (Klebsiella michiganensis M5al)
MEIRVFRQQDFEEVITLWERCDLLRPWNDPEMDIERKLNHDASLFLVAEVNGEVVGTVMG
GYDGHRGSAYYLGVHPEYRGRGIANALLNRLEKKLIARGCPKINIMVREDNDVVQGMYER
LGYEHSDVLCLGKRLIEDEEY