Protein Info for BWI76_RS20715 in Klebsiella michiganensis M5al

Annotation: RpoE-regulated lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF06572: DUF1131" amino acids 24 to 191 (168 residues), 280.3 bits, see alignment E=2.8e-88

Best Hits

Swiss-Prot: 79% identical to YFEY_ECOLI: Uncharacterized protein YfeY (yfeY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 88% identity to kva:Kvar_1280)

Predicted SEED Role

"Predicted outer membrane lipoprotein YfeY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B764 at UniProt or InterPro

Protein Sequence (191 amino acids)

>BWI76_RS20715 RpoE-regulated lipoprotein (Klebsiella michiganensis M5al)
MKSLRLLLCALPLALTGCSTMSSVNWSAAYPWNWFGSSTEVTEQGVGNLTASTPLSEQAI
GDALGSSYRLRSGMKTANGNIVRYFEALKDDKVALTINGESGTISRIDVRDSNIKAASGV
KIGTPFSDIYSKAFGNCQKGSNDNGAVVECKAEGSQHISYAFTGNWNGPEELMPSDDTLK
NWKVSKIIWRR