Protein Info for BWI76_RS20615 in Klebsiella michiganensis M5al

Annotation: sodium symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 36 to 53 (18 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 127 to 152 (26 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details PF13593: SBF_like" amino acids 8 to 316 (309 residues), 372 bits, see alignment E=2.7e-115 PF01758: SBF" amino acids 50 to 215 (166 residues), 41.7 bits, see alignment E=1.1e-14

Best Hits

Swiss-Prot: 87% identical to YFEH_ECOLI: Putative symporter YfeH (yfeH) from Escherichia coli (strain K12)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 92% identity to kpu:KP1_4003)

Predicted SEED Role

"Putative cytochrome oxidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B742 at UniProt or InterPro

Protein Sequence (332 amino acids)

>BWI76_RS20615 sodium symporter (Klebsiella michiganensis M5al)
MKFFRILDPFTLTLVTVVLLASFFPARGGFVPFFEHLTTAAIALLFFMHGAKLSREAIVA
GGSHWRLHLWVMCSTFIVFPVLGVLFAWWAPVNVDPALYTGFIYLCILPATVQSAIAFTS
LAGGNVAAAVCSASASSLLGIFISPLLVGLLMNLHGAGGSLEQVGKIMLQLLLPFVLGHL
SRPWIGNWVAKHKKWISKTDQTSILLVVYSAFSEAVVNGIWHKVGVGSLLFIVIVSIVLL
AIVIAINVFVARRCGFNKADEITIVFCGSKKSLANGIPMANILFPTSILGIMVLPLMIFH
QIQLMVCAVLARRYKRQAEALQAQEKNRASEA